McDonnell Genome Institute

Washington University

CircRNA

chr14|103335652|103339333|+|EIF5|ENST00000216554.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9625

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

2

Peptide

CLSMSTAACQTSSIATR

Amino Acids from 5' Exons

SCCAAIGTCIGETHTSKKLTASVAKIFSCQRPRTLAVVYVIPSSPDRRYQKVAIKDLFILLIKPLISQNVCQCQPQRVRPVLSLQDAPSDCQ,AVAQPLVPVLGKHSIQARSLQPQWRKFFHVRDRELLQSFMSSLLLQTEDTKKLQSKISSSYSHAKMSVNVNRSVSDQFYRYKMPRLIAK,LLRSHWYLYWGNIAYKQEAYSLSGENFFMSETENSCSRLCHPFFSRQKIPKSCNQRSLHLIDKATNKPKCLSMSTAACQTSSIATRCPVLP

Amino Acids from 3' Exons

KKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLR,KRKKRVLLIHLTKKSLLKQKDWMKPWALLFLKFFLMRRLENRLRNTGAISY,KERRGCYFIQRNRCSRKTGCKSHGPSCSNSSFEDRTDEIQAPFPT