McDonnell Genome Institute

Washington University

CircRNA

chr14|102049439|102049882|+|DYNC1H1|ENST00000555062.1

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9951

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

VVSSCPGLGWEWLWGK

Amino Acids from 5' Exons

GSCLGAGPTTRCLPAPSSSGCPTSARGSNSCRTSHWQLHLVAPRSRRRSRVSGGQQLSWAGVGVALGKNTGPRSDLSSFPWGLLLSTEHPRVPGWPVRAGVHHCHQAVCGPGQQLVPGGALPGSQRHHLTGRHPRLQLRSH,DLASELVPLHGACRHDRHPVGVRLQREDQTAAEHLTGSCIWWRQGAKGEGAPDESRVVSSCPGLGWEWLWGKTQGPGLTAPSPGGCCFPQNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTSQGATLDACSFGVT,ILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQVPELLPLGAAAFHRTSTCAWVACSCLRRTSLPPGSMWPRPTAGPWRSSAWKSTSPPHRAPPLTLAASESR

Amino Acids from 3' Exons

GSCLGAGPTTRCLPAPSSSGCPTSARGSNSCRTSHWQLHLVAPRSRRRSRVSGGQQLSWAGVGVALGKNTGPRSDLSSFPWGLLLSTEHPRVPGWPVRAGVHHCHQAVCGPGQQLVPGGALPGSQRHHLTGRHPRLQLRSH,DLASELVPLHGACRHDRHPVGVRLQREDQTAAEHLTGSCIWWRQGAKGEGAPDESRVVSSCPGLGWEWLWGKTQGPGLTAPSPGGCCFPQNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTSQGATLDACSFGVT,ILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQVPELLPLGAAAFHRTSTCAWVACSCLRRTSLPPGSMWPRPTAGPWRSSAWKSTSPPHRAPPLTLAASESR