McDonnell Genome Institute

Washington University

CircRNA

chr14|102029538|102030282|+|DYNC1H1|ENST00000360184.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9963

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

10

Peptide

VEPAVIEAQNGECSASK

Amino Acids from 5' Exons

ANARLAKRGGRTMAITPRHYLDFINHYANLFHEKRSELEEQQMHLNVGLRKIKETVDQ,RMLGQSEAAERWPSPLATTWTSSITMPTCSTRSGASWRSSRCTTWGSGRSKRQST,ECSASKARRQNDGHHPSPLPGLHQSLCQPVPREAERAGGAADALERGAQEDQRDSRP

Amino Acids from 3' Exons

VMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQN,LAKKSRNSCISSRRLQTNRVSKKILIRWNLPSLRPRM,YEPRNPGTAAAAGGNCRQTDECQRRSGGTCRHGPE