McDonnell Genome Institute

Washington University

CircRNA

chr14|102015855|102018616|+|DYNC1H1|ENST00000360184.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

18

Peptide

TYAEPLTAAMVEFYTMSQIQR

Amino Acids from 5' Exons

IQRDAATIMQPYFTSNGLVTKALEHAFQLEHIMDLTRLRCLGSLFSMLHQACRNVAQYNANHPDFPMQIEQLERYIQ,SKEMQLRSCNRTSRPTAWSPRRSTPSSWSTSWTHACAAWARSSPCCTRPAATWRSITPTIPTSPCRSSSWSATF,PKRCSYDHATVLHVQRPGHQGARARLPAGAHHGPNTPALPGLALLHAAPGLPQRGAVRQPSRLPHADRAAGALHS

Amino Acids from 3' Exons

VPAPRACRVCGLPGPRLPHTDLRHLQPRHAEAHSIPADVCRAAHCCHGGVLHHVS,FLRHVPVVYVDYPGPASLTQIYGTFNRAMLRLIPSLRTYAEPLTAAMVEFYTMSQ,SCATCLSCMWITRAPPPSHRSTAPSTAPCGSFHPCGRMQSRSLLPWWSSTPCL