McDonnell Genome Institute

Washington University

CircRNA

chr14|102005887|102012470|+|DYNC1H1|ENST00000360184.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9649

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

6

Peptide

LSLPPNITELVHQR

Amino Acids from 5' Exons

ITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPF,LQSWFTREMLQGPSKARLTTPNLLNGSARCDFTLTLSKLMCYSSCQFKWQMPNLTMALSTWVFRTNWSRPPSLTAAIQHKPWRPGWGVPHL,YRVGSPERCYKVLDQKQDQRQIFMAQPDAILLPANCVTAVVNSNGKCQILWLVPGCSGQTGPDPPHPLLFDNDTSLGGQAGGFPI

Amino Acids from 3' Exons

DHRQRERRAAEAPVDRLRWRCGSRVGELELSAGQAPNFAQWRAPQSSTQ,IIDSVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPN,SSTAEASCRSASGSSSMAMWIQSGLRTTQCWMTISSLCPMESASVFHP