McDonnell Genome Institute

Washington University

CircRNA

chr14|102002536|102036642|+|DYNC1H1|ENST00000360184.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9239

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

8

Peptide

FGNPLLVQVFEEDALSWEDK

Amino Acids from 5' Exons

VFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHLLPVETQRFQ,FLKRMLSAGKISTGSWLSLMCGLMCRGGGSTWKVSSQAVQISSTCCQWKPSGFR,FRGCSQLGRAEQDHGSLCVDCAEAVGLPGRYLHRQCRYQAPAASGNPAVSE

Amino Acids from 3' Exons

VSADHPLWTGHRIHYEIGSDHTDQLPGRLQKELRECTEIRPPSGP,YPLIIDPSGQATEFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQ,IRSLTPLDRPQNSLMNIRIVRSHGPASWMTPSERTRVHDSVTPFWS