McDonnell Genome Institute

Washington University

CircRNA

chr14|101985686|101987632|+|DYNC1H1|ENST00000360184.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9037

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

4

Peptide

LDMEVTAVAQQNQGEVPEPQDMK

Amino Acids from 5' Exons

VTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETVFNFQEK,SRQLHNRIKERSLNPKIKWLRFSLMLQMQMPLRKTLLMRTSRKWMDWMFPKRARKPGRLLRGTMRGSTEWRPGSPLAFGISLAQPRMPTRCLGFSPGLMHCLSGLTSVGPFANTRPSSSAKMTLSLFTTSSRSSTHRVRLVRVTFVTCPLCQGLSSGLNRSTGSRPTSGWKMSLARAGRITWRGRSSRMETASASSTRRRSLMTGQGRCSSATSVSRGAFSPSKVLGFGAELEMCLSKLTFFLRLSHYPKKSGTSNGLVSASHWRLTKPIKQTSFTRLPSHSRAFVPMNGPARRWRSGTPFPFWWLAKRKCRPSQKALRWCGSPTNLTHMYSAQRLSSTSKK,HGSCTTESRRGPTPRYESGGSLCCRCKCHGSKPCLERQGSGWTGCFQRGHGSLGGCYEEVREDRQSGDPDHRSPSGSAWHSQECQRDVDFLQVCTVCQASHPWGHSRIPDPADPARERHVSSRQVQGPVPTESGLDESRSLAPCVRVYHLGTDRQAADGLHEAGGRCPWQGLGESRGGAEAEAGWRQLPHEAQHAGDLLGKEGAAAQPRCLGAHFHHRKYSGSGPNWKCAAESLSSDYHTIQRSPEPQMAWFPRPTGDCEQSPSSKPALPVCHLTDRERSYLTDLREGGGAEHHFPFGGWLEKGSAGPDRRRHCVGVGVLQTPICTALSRDCLQLPRK

Amino Acids from 3' Exons

VDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDME,WMICSLKKKTKSVPWKLVCMTIRHSRKSTESRKQWMTICTPIPICPSGSTSLTW,GSADHRKNRPRSPFLGNLYVPDILGNLEQSPESSGLKSALLFQFAHLGQQAHG