McDonnell Genome Institute

Washington University

CircRNA

chr14|101975711|101979492|+|DYNC1H1|ENST00000360184.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9412

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

QTEDVGDEGEEEK

Amino Acids from 5' Exons

RTSVMKEKKKKNSFPITSTTFIMGLNPI,GRRRRRRKRIHFLHQHRHSLWGIQ,DVGDEGEEEKEFISYNINIDIHYGVKSN

Amino Acids from 3' Exons

LGIHTYSRDCRTRVFSAPGPYTQRLALRNFAFFHQCSGSFFVLHRVWQGRQ,LAFIKRTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKAD,WHSLNVLPLMQINPCLLSSGSLHSVKTRPTKLCILSLAMQWLLFLSPTLESLARQT