McDonnell Genome Institute

Washington University

CircRNA

chr14|101786017|101856885|+|PPP2R5C|ENST00000328724.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9193

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

VPVSQPIVK

Amino Acids from 5' Exons

QISVRKNSLVAVPSTVSAKIKVPVSQPIVKKDKRQNSSRFSASNNRELQKLPSLK,KFPSGKTALLLSRLQYLLKKYQSLSPRKTNGKILQGLAQAIIENFKNYHPK,NFRQEKQPCCCPVYSICNKSTSLSAHSEERQTAKFFKVRKQRTSKTTILK

Amino Acids from 3' Exons

MFLLLIKRSFLSRSYVSVASSLTLFLIHVTSGRKNELLVKWNISPIIGMSQSLFTQKSI,CSSCSREAFYPEVTSVLRPLLCFSTKPKVEGSKTSCFKNGRIYHPSECDHRAYLPRSSPY,VPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHM