McDonnell Genome Institute

Washington University

CircRNA

chr13|98829306|98846060|-|DOCK9|ENST00000340449.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

NQEGLGPIVHDR

Amino Acids from 5' Exons

HTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSE,TPASPLMRTPKGYARCWPPPRRSMRTTQRCWWTSSTAWPNPMPARPSSGRRGSTAWPGSMSKMAISQ,HQLLLCEGLNQKDTHGANGHRPDEGAERPRDAGGPPVQPGQILCQHARAQEDVARQHGQDPCQKWRSLR

Amino Acids from 3' Exons

EPGGVGTHSSSKVSDIACFPQNRNDACQIAAAGQPGLSHFP,NQEGLGPIVHDRKSQTLPVSRNRTGMMHARLQQLGSLDNSLTFNH,TRRGWDPFMIESLRHCLFPVTEQECMPDCSSWAAWITLSLLTT