McDonnell Genome Institute

Washington University

CircRNA

chr13|98440122|98446817|+|FARP1|ENST00000319562.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9635

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

AESEYTFESSR

Amino Acids from 5' Exons

FSVRDGEVGGHPDGHPGGEEQQPRPVPGQQPPQ,SRSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDN,LGPRWRSGLRTSRWPLTWRRRAAAPPLSSWPAAPLTT

Amino Acids from 3' Exons

DNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFE,TIIPLPACLCSATRSPSPLSPRTSRKTTCSSCTSSPTSTTSGRKASTRSK,QSSPCQPASARLLAHHPLVREHPERLRVQAALQVPRLLLQGGKRVHVRK