McDonnell Genome Institute

Washington University

CircRNA

chr13|98016728|98019809|+|IPO5|ENST00000261574.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9703

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

15

Peptide

EEAVQTFNYLCDLIER

Amino Acids from 5' Exons

DDNDVYILTKVSDILHSIFSSYKEKVLPWFEQLLPLIVNLI,MIMMFIFPKCQIFYTQYSVATKKRCYHGLNSCFHLSTS,CLYSDQSVRYFTLNIQLQRKGVTMVTAASINCQPH

Amino Acids from 3' Exons

KHFPCWELFSLRILRPKKMSMLQRTASQQGKSSSSLTVTLKRSFHTGCLGFHYMKIKKKLFRLSIICVTLK,STSPAGKSYSVCGFDQRKCQCYRELHLSSRENHEVQALCKRRGPSTLVVLASTTRRRSCSDFQLSVPDK,ALPLLVRVIQSADSKTKENVNATENCISAVGKIMKFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFNYLCDLIE