McDonnell Genome Institute

Washington University

CircRNA

chr13|97992891|98010224|+|IPO5|ENST00000261574.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9634

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

7

Peptide

STACQMLAVNDSCYQNDDSVLK

Amino Acids from 5' Exons

AVNDSCYQNDDSVLKSLVEIADTVPKYLRPHLEATLQLSLK,RMTRATRMMILSNPSLRLQILFQSICVLTWKQLYSV,GKLVLPEFCPKIPRDCRYCSKVFASSLGSNSTAKSK

Amino Acids from 3' Exons

PKTWRIVMMMVGNLTLEISKALVLKLQDKKNQLLARC,PRHGEYEWLGICEPWRSAKLWYNCRTRRKINCLPDV,QDMENMSDDDGWEFVNLGDQQSFGIKTAGLEEKSTACQML