McDonnell Genome Institute

Washington University

CircRNA

chr13|97346803|97356849|+|MBNL2|ENST00000469707.5

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9221

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

9

Peptide

RPLEATVDLVCREFQR

Amino Acids from 5' Exons

VCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKA,YAGSSSEETVPGERPTAALHTPQTAPSTQVTTPPFVWITRGVAGRNANIFTLLHTCRPKSKL,MQGVPARKLCPGRDRLPLCTPRRQHHDRHKQHRNRLYGLHKGALHEGEMQIFSPSCTLAGQNQSC

Amino Acids from 3' Exons

TQSTAKAMKRPLEATVDL,LSRLPKQSDLSKQLT,SVDCQSNEATSRSNCRP