McDonnell Genome Institute

Washington University

CircRNA

chr13|95902853|95940091|-|UGGT2|ENST00000376747.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9692

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

TFLIEMYQK

Amino Acids from 5' Exons

KTSVHSRLGIIYNPTSKINEENTAISRGILAAFLTQKNMFLRSFLGQLAKEEIATAIYSGDKIKTFLIE,KQVFIVGWGLFIILHQKMKRTQLFLEEFWQLFLHRRTCFEAFLGNWQRKKLLQLFTLEIKLKHSLL,NKCSSVGDYLSYIKNKREHSYFRNFGSFSYTEEHVFEKLSWATGKGRNCYSYLLWRNNIPY

Amino Acids from 3' Exons

MYQKVKKDQNILTVDNVKSVLQNTFPHANIWDILGIHSKYDEERK,CTKKRRIKIYSLWTMRVFSKIHFLMLIFGIFWEFILNMMKKE,VPKSEEGSKYTHCGQCEECSPKYISSCYLGYFGNSFIRKK