McDonnell Genome Institute

Washington University

CircRNA

chr13|95856157|95887971|-|UGGT2|ENST00000376747.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9345

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

IIFVDADQVLGK

Amino Acids from 5' Exons

EVIPHMAKEYGFRYELVQYRWPRWLRQQTERQRIIWGYKILFLDVLFPLAVDKIIFVDADQ,KFLTWLKSMDSDMNFNIGGPVGFVNRLKDRGLFGVTKFFSLMFFSHQWTKSFLLMLT,SNSSHGRVWIPITSSIVAPLASSTDKTEDYLGLQNSFPCSFPTSSGQNHFCCP

Amino Acids from 3' Exons

VLGKIINMKIKLFMNCRGRLSEAPLE,YLARLSTRSCSTVGAGFQKPLK,TWQDYQHEDKVVHELGQAFRSPFRK