McDonnell Genome Institute

Washington University

CircRNA

chr13|93830153|93830545|+|GPC6|ENST00000377047.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9484

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

NFSESSWR

Amino Acids from 5' Exons

NFSESSWRMQKSHMICLYGPMACCTCRIQKSSRTSSQSKGTTLGVMIWRKCSMTFGLGSWNGCFSTLSITSVKTTWNVANTLTSSSHLETCPGNRFRLPAPSLLPGPLSRGLWAEKLQTEFP,IFPRAPGECRKVTKYVCTDLWHAVHAEFRSLPGPLHRAEKVLHWGCESGGNAQLLGSAPGTDVSADKPSVSLQRLPGMCEQIHPAQAIWRRAPETEDSGYPRLHCCQDLCPGADCGQRSCKPSFQ,FFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSK

Amino Acids from 3' Exons

NFSESSWRMQKSHMICLYGPMACCTCRIQKSSRTSSQSKGTTLGVMIWRKCSMTFGLGSWNGCFSTLSITSVKTTWNVANTLTSSSHLETCPGNRFRLPAPSLLPGPLSRGLWAEKLQTEFP,IFPRAPGECRKVTKYVCTDLWHAVHAEFRSLPGPLHRAEKVLHWGCESGGNAQLLGSAPGTDVSADKPSVSLQRLPGMCEQIHPAQAIWRRAPETEDSGYPRLHCCQDLCPGADCGQRSCKPSFQ,FFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSK