McDonnell Genome Institute

Washington University

CircRNA

chr13|77257670|77262129|-|MYCBP2|ENST00000357337.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9218

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

14

Peptide

GTGFDEESAILGAGR

Amino Acids from 5' Exons

VWLIRAILLRLWAKLTLVFRMERCGHLVIIKDSVDEILVPTKVGK,FGNFEGPFCNSGSYGQSSHLCFNEEWRGVDIWCKRTVWTRYWCHEPRWE,LVTDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCGRDTGAMNQGGK

Amino Acids from 3' Exons

VQDLMRSQQFLVQDESLRKQQME,YRIGVSNSWCRTRVCANENSKWK,TGFDEESAILGAGREFALMKTANGK