McDonnell Genome Institute

Washington University

CircRNA

chr13|77126317|77129230|-|MYCBP2|ENST00000498073.2

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

DLDVFSWTSK

Amino Acids from 5' Exons

ESKTNTDDFFKDINSCCPQEATMQEQDMPFLRGGPGMYKVVKTGPSGHNIRSCPNLRGIPIGMLVLGNKVKAVGE,NLKLILMTFSKTTPAAHRKQQCKNKICHSCEEGQACTRRRDLQVTTSEAALTLEVSQLECFWETKSKQWE,INYLFQRHKLLLPTGSNNARTRYAILARRARHVQGSEDGTFRSQHQKLPPRYPNWNVSSGKQSQSSGR

Amino Acids from 3' Exons

NIFNASQGVRDLDVFSWTSKAFFPQ,ISLMLAKESGIWTYFHGLPKLFSP,YLCPRSQGFGRIFMDFQSFFPP