McDonnell Genome Institute

Washington University

CircRNA

chr13|77095357|77140943|-|MYCBP2|ENST00000357337.10

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.906

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

DDTTRNSVGQTK

Amino Acids from 5' Exons

VKQSRRKPMQVKTPRALPTMEAHQVIKANALFLLSLSSAAEPSILCYHPAKPFQSQLPSVKEGISEDLPVKMPCLYLQTLA,SNNLGENQCKSRPLVPCPPWKLTRLKPMHSSCCPAVQQNRAFCVTILQSHSNLSCPVKKAFLRIFLKCLVSTCRHL,QTIEKTNASQDPSCLAHHGSSPGDSQCTLPAVPEQCSRTEHSVLPSCKAIPISVAQCKRRHFGSSCENALSLPADIS

Amino Acids from 3' Exons

MLVWKKKTHQKGYHQELSWSNQSLNLSLI,CWSGSKSKRPTKRDDTTRNSVGQTKVTSA,AGLEVKVKDPPKGMIPPGTQLVKPKSEPQPNK