McDonnell Genome Institute

Washington University

CircRNA

chr13|75840390|75849292|+|LMO7|ENST00000321797.12

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9799

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

VAGCGIK

Amino Acids from 5' Exons

LPVPTISAPSRWVWDQEEERKRQERWQKEQDRLLQ,FQFQPSVPRVAGCGIKRRSGSGRRGGRRSRTAYC,SSSNHQCPESLGVGSRGGAEAAGEVAEGAGPPTA

Amino Acids from 3' Exons

ETINITKLGTPLHRGDPRKNKYHQEQNWRGNKSFRKGREHPFTMTTAGSDSAVPVSTKSLLVFLGSE,KQIFRPNWEHDLFTEEIQERTSTIRSRIGEATNPSGNEEENTPSQQQLDPTAQCQCQQRACSSWDHEK,NNKYLDQIGNMTSSQRRSKKEQVPSGAELERQQILQEMRKRTPLHNDNSWIRQRSASVNKEPVSLPGIMR