McDonnell Genome Institute

Washington University

CircRNA

chr13|75833050|75835339|+|LMO7|ENST00000485987.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

TLNLTSMATK

Amino Acids from 5' Exons

DQFSDMRISINQTPGKSLDFGFTIKWDIPGIFVASVEA,ISSVIESATRRLGRVLTLGLQNGIFLGSSHQLKQ,SVQYENQHKPDAWEESLWVYNKMGYSWDLRSISS

Amino Acids from 3' Exons

TGAKTNLPCHLYGIKPSISPVWLPKLVHLKQSGLMQLLEFTTQKNLQIYLQLISPKAFRV,LGQRPTFPAIYTANPQSHQYGYQNYRFTNKVDCNFWNLQLRKIFKSICNNFLRKPSEF,WGKDQPSLPFIRHKTLNLTSMATKIIGSPETKWIDATSGIYNSEKSSNLSVTTDFSESLQSS