McDonnell Genome Institute

Washington University

CircRNA

chr13|75823564|75849292|+|LMO7|ENST00000321797.12

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9405

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

RWMMLGSIMEMLK

Amino Acids from 5' Exons

MDDAWKYNGDVEDIKRTPNNVVSTPAPSPDASQLASSLSSQKEVAATEEDVTRLPSPTSPFSSLSQDQAATSKATLSSTSGLDLMSESGEGEISPQREVSRSQ,WMMLGSIMEMLKTLRELQTMWSAPLHQARTQANWLQAYLARKRQQQKKMQGCPLLHPPSHLFPKTRLPLLKPHCLPHLVLICLNLEKGKSPHKEKSQDP,GCLEVWRCRHENSKQCGQHPCTKPGRKPTGFKLIPERGSSNRRRCDKAALSYIPLLISFPRPGCHFSHIVFHIWSFNVIWRRGNLPTKRSLKIP

Amino Acids from 3' Exons

ETINITKLGTPLHRGDPRKNKYHQEQNWRGNKSFRKGREHPFTMTTAGSDSAVPVSTKSLLVFLGSE,KQIFRPNWEHDLFTEEIQERTSTIRSRIGEATNPSGNEEENTPSQQQLDPTAQCQCQQRACSSWDHEK,NNKYLDQIGNMTSSQRRSKKEQVPSGAELERQQILQEMRKRTPLHNDNSWIRQRSASVNKEPVSLPGIMR