McDonnell Genome Institute

Washington University

CircRNA

chr13|75760931|75804541|+|LMO7|ENST00000321797.12

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

15

Peptide

SWASPVYTEADGTFSR

Amino Acids from 5' Exons

DNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTV,IITFSKLVNRLDKKPSFSILEIYRIYQIESLS,YKRFLESLTDWIERSPAFPSWRSTGFIKSSHCQ

Amino Acids from 3' Exons

VLKVTQIRNLHLRCRIIIKMICRIEGFRLLSQRLRYPSIVFYPTKVDSHPMYQHLERKSQTNMRITEEVGQARFIQKQMEHFQ,FKHRFGIYIDAGLRYVVSKDFGCAKDCVTLQSFFTQQKTAILCTSTSEKEKARQTGQKKLGKPGLYRSRWNIFK,FESDTDSEFTFKMQDYNKDDMSYRRISAVEPKTALPFNRFLPNKSRQPSYVPAPLRKKKPDKHEDNRRSWASPVYTEADGTFS