McDonnell Genome Institute

Washington University

CircRNA

chr13|75713181|75823873|+|LMO7|ENST00000341547.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9551

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

SQAVTEK

Amino Acids from 5' Exons

AVTEKNFETKDFRASLENGVLLC,QQRRILKQKIFEPLKMVFCCV,SNREEFNKRFSSLSRKWCSAV

Amino Acids from 3' Exons

MDDAWKYNGDVEDIKRTPNNVVSTPAPSPDASQLASSLSSQKEVAATEEDVTRLPSPTSPFSSLSQDQAATSKATLSSTSGLDLMSESGEGEISPQREVSRSQ,WMMLGSIMEMLKTLRELQTMWSAPLHQARTQANWLQAYLARKRQQQKKMQGCPLLHPPSHLFPKTRLPLLKPHCLPHLVLICLNLEKGKSPHKEKSQDP,GCLEVWRCRHENSKQCGQHPCTKPGRKPTGFKLIPERGSSNRRRCDKAALSYIPLLISFPRPGCHFSHIVFHIWSFNVIWRRGNLPTKRSLKIP