McDonnell Genome Institute

Washington University

CircRNA

chr13|60467237|60494575|+|TDRD3|ENST00000196169.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.938

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

5

Peptide

VSIENCLNTPPGTK

Amino Acids from 5' Exons

PEHTTWNSALRHCHKKWIPALELHHSSWWSGTPYEMGVTE,LNTPPGTKVKLSGIVDIKNGFLLLNDSNTTVLGGEVEHLIEKWELQR,THHLELKLSSQALLTKMDSCSMTLTPQFLVVKWNTLLRNGSYR

Amino Acids from 3' Exons

TKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYREL,PRHLEEVVVVLEVISIMLLVTEIGKFYRKKSQPNQRENMKVSIEN,QDIWRRWWWCKSQYECCWPKGSFTERKVNQIRGKTRCLRT