McDonnell Genome Institute

Washington University

CircRNA

chr13|49921477|49928085|-|SPRYD7|ENST00000361840.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9937

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

10

Peptide

GTVYPVVYGIWGIGVATQK

Amino Acids from 5' Exons

GITYDHVELNVYLNGKNMHCPASGIRGTVYPVVY,VLLMTMSNMYTMEKTCIVQHQVYEGQCIQLFM,YYLPCRIKCILEWKKHALSSIRYTRDSVSSCL

Amino Acids from 3' Exons

ESGVLVLQLRRLTIRFLLAEICTVWEMMEPFTTTMKRKIGCQQTVFRRKEMW,NLGYWCCNSEGLESDSSWPRYAQSGDEKWSPLPQQREKAASKQSSAGRRCG,IWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVV