McDonnell Genome Institute

Washington University

CircRNA

chr13|49185963|49188633|+|FNDC3A|ENST00000398316.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9294

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

11

Peptide

VYCISDGGQSAVIAYNSEGK

Amino Acids from 5' Exons

VIAYNSEGKSNPSEVVEFTTCPDKPGIPVKPSVKGKIHSHSFKITW,LLLTTQKVKVIQVKNLLLALINQAYLSLQKERYIHTVLKPG,YCLQLRRKSKSSRIYYLPTRHTCKAFSERKDTFTQFNNL

Amino Acids from 3' Exons

ETNGKYTVVLPGNIFVIDIQAVSIVYEFTASVMEDRV,KQMGNDIQWCYQGTSLSTESRLFLSFTSLLHQWRTEC,NKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSA