McDonnell Genome Institute

Washington University

CircRNA

chr13|48376917|48381443|+|RB1|ENST00000267163.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9855

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

9

Peptide

IMESLAWLSNCTVNPK

Amino Acids from 5' Exons

NCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQ,TAQIQKKVYKERIDTSLKRNLLKLWDRVVSKLDH,LHSESKRKYTEKSEGYRIHLREICSCGTGLCRNWIT

Amino Acids from 3' Exons

EVHLRILILEQICLSHGFMCLIKPLIFTKSKVLSKQKATQEKNINDVNIESWNPLHGS,KYISESFWNRFVFPMDSECAFKSLFLQSDRKFYQSRRQLDKRNDKTFRTMTSNHGIPCMAL,STSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLS