McDonnell Genome Institute

Washington University

CircRNA

chr13|48367493|48459833|+|RB1|ENST00000267163.4

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9955

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

4

Peptide

HLDQVENLSK

Amino Acids from 5' Exons

VENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSID,LKIFLNDTKKFILKIKIMQDYFWIMIKLFRLILT,KSFTIRRNLSKRSRCKIIFGSNSSDFYRQ

Amino Acids from 3' Exons

CIGPISGIHFVNAFCLSTQNNISSGPFSSTPCRMSMNSETGIWT,VSASLSPAKYTLTPSVAPRIRTYHLDPFPAHPAEVTHERQAFGP,YRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQ