McDonnell Genome Institute

Washington University

CircRNA

chr13|46650200|46669156|+|LRCH1|ENST00000311191.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9286

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

QLMELTYLK

Amino Acids from 5' Exons

TYLKTDWLKFQWNCAILYHWKFLICITTVSESFLRPSLICRCLTT,LIKQTGSSNGIVPFCITGNSSVSQLYQSHSGHRSADADLPELE,LSKNRLVEVPMELCHFVSLEILNLYHNCIRVIPEAIVNLQMLTYLNL

Amino Acids from 3' Exons

SKSAVRPACLPVWSASQSLNRKQQTWIITRRDRSAQTVNGA,RNQLSALPACLCGLPLKVLIASNNKLGSLPEEIGQLKQLMEL,EISCPPCLPACVVCLSKSSQVTTNLDHYQKRVSSNSWS