McDonnell Genome Institute

Washington University

CircRNA

chr13|46130813|46143404|-|LCP1|ENST00000323076.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9732

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

14

Peptide

LNNANDLSDALVIFQLYEK

Amino Acids from 5' Exons

DPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNA,TRRLVQVCLFWTSSMPSNQVPLTMTFRQKIMMMRNSTMQ,PEDYKSACSGPHRCHPTRFHLPSEDRKSEETQQCK

Amino Acids from 3' Exons

LIRCPGHLPALKDQSSCLEQSKQTAIPQTGRQYEE,DLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKK,TYQMPWSSSSSMKRSKFLLTGTETNRHTPNWEAIR