McDonnell Genome Institute

Washington University

CircRNA

chr13|45985296|46042275|-|ZC3H13|ENST00000242848.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9191

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

DLQGILEK

Amino Acids from 5' Exons

ILGANETEKRTQEKNENMNRIRALLETTEMTENLEMVGIGEMPEILGTEGNETPETCGTQGREIIAEIPKRAVIPEILGPLVMPMTTGTVKVEILIERRIHIQKNPGVMAETIEKKVLVRKGMSPEMSLEVKLEMTEWAEVGGGFLSYLKR,YGQTRQRKGLKRRTRITGSELFRPQRQRTSRWSGSERCQRYGPKGTKRLQRHAGLKGDERLQRYQREPSQRFSVHSCPLQGPRSRYSSKGGYISRRIPELWPKPFERRKFSYGNKEVQKVSKNKPNGPKGEGSVTK,TRGKRDREKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTKESRDPRDSRSTRDAHDYRDREGRDTHRKEDTYPEESRSYGRNHLREESSRTEIRNESRNESRSEIRNDRMGRSRGRVPELPEK

Amino Acids from 3' Exons

VTRKTYRGSRKNEEQAPRRGHAPETKYRGVILTC,SPERPTGDLRERMKNKRQDVDTEPQKRNTEESSSPVR,HQKDLQGILEKERTSAKTWTLSPRNEIQRSHPHLL