McDonnell Genome Institute

Washington University

CircRNA

chr13|45963841|45970465|-|ZC3H13|ENST00000242848.8

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

TVMPTTVEMIK

Amino Acids from 5' Exons

IPMMWIGLVLCQSIQKNHESLGLHSNSHLELLCELGFLKSWQVLNSLPKSKKHVRDFKNPK,SLRCDRCGLVWSYAKASKRTTRAWGCTLKIHTWSCYAKSWDFKVGRFTLCQSQRNMSETFRKTQ,PLDVIDVDWSGLMPKHPKEPREPGAALLKFTPGAVMLRVGISKKLAGSELFAKVKETCQRLLEKPK

Amino Acids from 3' Exons

EALKRESQPTVPEAPATFSGQCLQQWR,KRYRNEGSPSPRQSPKRRREHSPDSDAYNSGDDK,SAIEMKGVPALDSPRSAGVNILRTVMPTTVEMIK