McDonnell Genome Institute

Washington University

CircRNA

chr13|45405882|45409074|-|SLC25A30|ENST00000519547.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9461

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

8

Peptide

LFIERPEGTFPIDLTK

Amino Acids from 5' Exons

DCPRDVTPGILWHHQDRHLPELEATIHTPR,IAPAMLRQASYGTIKIGTYQSLKRLFIERPE,LPPRCYARHPMAPSRALTRASDYSLNAQK

Amino Acids from 3' Exons

VHFQLIPRHGSRFKARRMMQNLRKLDTEECCTHGAEKKGKHSTR,YISNFNQDTAPDSRPDECKIGNIPRNVARISEDRQRRRAESTLLG,TFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYS