McDonnell Genome Institute

Washington University

CircRNA

chr13|41721369|41833531|-|VWA8|ENST00000281496.6

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9246

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

HLQDMTAR

Amino Acids from 5' Exons

VIFLAAMQLITPNPTRSSRCSDSMDQMCLSPSFRSLWLPLESGVWLTKGLLTILILPEKLSTSNIY,YFLPCSPQTPLGARDAQTVWTKCAAHPSEACGCLWRAEEFGPRDYLSLFYQRSCQHSQTFT,DIFSCHAVDNPKPHSELEMLRQYGPNVPEPILQKLVAAFGELRSLADQGIINYPYSTREVVNIVKHLQ

Amino Acids from 3' Exons

DMTARDLLQQRYTLPNGDTAWRSSPLVNAALEGKLVLLDGIHRVNAGTLAVLQ,IQRVICYSRDTPFQMETLPGGPHPLMLLWKASWSCWMAFTGMRARLLYCK,YDSASATAEIHPSKWRHCLAVLTPCECCSGRQAGPAGWHSPGECGHACCIAK