McDonnell Genome Institute

Washington University

CircRNA

chr13|41670945|41701530|-|VWA8|ENST00000379310.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9831

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

14

Peptide

NMQGPALINIQEYPIER

Amino Acids from 5' Exons

IRISLAVYHMAVDHFRHRCTAGVGQKRCCYCYGRSHQALGNWTTSAAITHGMEKHDWTRQKYA,SESLSPYTTWLSTISDTDALLAEWDKSGVVTVDMGGHIRLWETGLERLQRSLMEWRNMIGQDDRNMQ,QNLSRRIPHGCRPFQTQMHCWLSGTKAVLLLLIWEVTSGFGKLDLNVCSDHSWNGETLDKMTEIC

Amino Acids from 3' Exons

GPALINIQEYPIERHEERSLNFTEECASWRIPLDEINIICDIATSH,VQHLIYRSIQKDMKKDPTLLKNVPHGEYHWMKLISVTLLHHM,SSTYKYTGVSNRKTRKIPKLYRMCLMENTIGNYNLHCYIT