McDonnell Genome Institute

Washington University

CircRNA

chr13|41605167|41703411|-|VWA8|ENST00000379310.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9184

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

5

Peptide

IILDNLQVDSAR

Amino Acids from 5' Exons

AKGDPNEIRCCNLKVFRCCSATGALPPNHPGFT,LKEIQMSEYDAATYERFSGAVRRQVHSLRIILDNLQ,RRSKVNTMLQPMKGFQVLFGDRCTPSESSWIIY

Amino Acids from 3' Exons

VDSARTNVHGLLDNWSGKKWDAKTLVSSGNSSYRHK,LTLPEQTFMGYWTIGQARSGMQKLLCPVETHHIDIK,LCQNKRSWATGQLVRQEVGCKNSCVQWKLIIT