McDonnell Genome Institute

Washington University

CircRNA

chr13|36326574|36329517|-|SPG20|ENST00000355182.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9223

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LYHVSQFQK

Amino Acids from 5' Exons

AKDTSSEEVNLSHIVPCEPVPEEKPKELPEWSEKVAHNILS,LKILQVKKLTVTLYHVSQFQKKSQKNYLNGVKKWLTTFCQ,RYFKRSPESHCTMASSRRKAKRITMEKSGSQHFV

Amino Acids from 3' Exons

ANWNRAEEENEFQIPGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKR,PTGTEQKKKMNSKSLEELDPPLTNKKPLALMNSWTKAIRMYVIKENVEK,QLEQSRRRKIPNPWKNTLLPTKRSLWHCETVGPRQGCTSRKTWKK