McDonnell Genome Institute

Washington University

CircRNA

chr13|36312144|36312477|-|SPG20|ENST00000355182.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

12

Peptide

LSDTIDGVCTVANCVGK

Amino Acids from 5' Exons

DFQLSGKDWNVQLNASLTMFQQKLYKLSDT,IFNCLARIGMCSMHRQCFSRNCTNCQIQ,FSTVWQGLECAAKCIVNNVSAETVQTVRY

Amino Acids from 3' Exons

LMEFALQIALEKNLHMSRSMEANLFQNLLKKTKMGNLLWMVLWLQQVVFK,WSLHCSKLRWKRTSSTCQEAWKQTCSRISKRQRWEISSGWCYGCSSKCS,DGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMVVAASSVQ