McDonnell Genome Institute

Washington University

CircRNA

chr13|33060678|33061780|+|KL|ENST00000380099.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9974

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

LGEPLHCPGLCR

Amino Acids from 5' Exons

VDTTLSQFTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK,IPLCLSLPTMFTCGMSTTVKGLLKWMGLPRRGNPTVLTLLPSSPRSLYSRKCTLHIFASPWTGPFSLWVTSPRTTPSCSTIAAWPASLSVSTSPQWWPCGSLWPRTKDCRASWPGRAPGRTPTLPWPLQSMPDCAFKSSAITSSFGRMSRIQGIHTVLATTFRPMPWLGMCTMKSLGMLRMGKYPPCRLIGNLPALSPKRTKRWLREFWNLTLAGWLSPFSALEIIHGGTGTKETIFFFLISLKMKKSSRVPLTFWLAIIPPSLTQKKKIQNTMITKCKKPTSRGSTPPVRWRCPGGCAKCTGSSSTETSPCTYPMESMTGCMLRTTSGCIICRITTKLSK,RYHSVSVYRPECLPVGCPPQKAYSGWGCDQEEEILLCLCCHPAPDRFTPGNARYTFSLLPGLGPDSPSGPVPGEPHHPAVLSLHGQRACPCQHHPSGGPVAAYGPEPRTAAPPGQAGRLGEPLHCPGLCRVCPTVLSRARPSRQALDNDEAVYKEYDIQCWPQPSEGPCPGLACVQKVACSEWENIHSLAGLDRTCLPFLPKGQRGGESFGIHWLAGAHFRLWRLSMGDEGLAEPKKQFSSSLFHRKKANPGYLLFGFKPLYHHPCRLRKRRSNKIQLPRSARNDRHHVAQLPQSGGGSALGVAQSAELAEVQVRRPPHVHNIQWNRRAACGRPAEGVLYAELHKRSSQ

Amino Acids from 3' Exons

VDTTLSQFTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK,IPLCLSLPTMFTCGMSTTVKGLLKWMGLPRRGNPTVLTLLPSSPRSLYSRKCTLHIFASPWTGPFSLWVTSPRTTPSCSTIAAWPASLSVSTSPQWWPCGSLWPRTKDCRASWPGRAPGRTPTLPWPLQSMPDCAFKSSAITSSFGRMSRIQGIHTVLATTFRPMPWLGMCTMKSLGMLRMGKYPPCRLIGNLPALSPKRTKRWLREFWNLTLAGWLSPFSALEIIHGGTGTKETIFFFLISLKMKKSSRVPLTFWLAIIPPSLTQKKKIQNTMITKCKKPTSRGSTPPVRWRCPGGCAKCTGSSSTETSPCTYPMESMTGCMLRTTSGCIICRITTKLSK,RYHSVSVYRPECLPVGCPPQKAYSGWGCDQEEEILLCLCCHPAPDRFTPGNARYTFSLLPGLGPDSPSGPVPGEPHHPAVLSLHGQRACPCQHHPSGGPVAAYGPEPRTAAPPGQAGRLGEPLHCPGLCRVCPTVLSRARPSRQALDNDEAVYKEYDIQCWPQPSEGPCPGLACVQKVACSEWENIHSLAGLDRTCLPFLPKGQRGGESFGIHWLAGAHFRLWRLSMGDEGLAEPKKQFSSSLFHRKKANPGYLLFGFKPLYHHPCRLRKRRSNKIQLPRSARNDRHHVAQLPQSGGGSALGVAQSAELAEVQVRRPPHVHNIQWNRRAACGRPAEGVLYAELHKRSSQ