McDonnell Genome Institute

Washington University

CircRNA

chr13|33053766|33061780|+|KL|ENST00000380099.3

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9025

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LSLDQSSK

Amino Acids from 5' Exons

AHAKVWHLYNTSFRPTQGGQVSIALSSHWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKKFIKGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHPQIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLK,LMPKSGISTILLSVPLREVRCPLPALTGSILEEPTTASKNVKNLWTLYVGLPNPYLLMVTIPRARITFHLFCLILLNLRKSSSKELLTFLLFALDPPVFNFWTLTSSANWNLPTGNCFPGLTLNLTILKYLLWKMAGLSQGPPREMMPNICITSKSSSWKPK,SCQSLASLQYFFPSHSGRSGVHCPKLSLDQSSKNDRPQHQRMSKISGLCTRLVCQTRIYWLSREHEEPFIYSAFYIEKVHQRNCLFCSLLWTHLEFSTFGPSHEVPPIGISQPEATAFLDPIPSSNIYCGKWLVCLRDHQERCQIYVLPQKVHHGNLK

Amino Acids from 3' Exons

VDTTLSQFTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWALILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENPYTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRHAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQRNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK,IPLCLSLPTMFTCGMSTTVKGLLKWMGLPRRGNPTVLTLLPSSPRSLYSRKCTLHIFASPWTGPFSLWVTSPRTTPSCSTIAAWPASLSVSTSPQWWPCGSLWPRTKDCRASWPGRAPGRTPTLPWPLQSMPDCAFKSSAITSSFGRMSRIQGIHTVLATTFRPMPWLGMCTMKSLGMLRMGKYPPCRLIGNLPALSPKRTKRWLREFWNLTLAGWLSPFSALEIIHGGTGTKETIFFFLISLKMKKSSRVPLTFWLAIIPPSLTQKKKIQNTMITKCKKPTSRGSTPPVRWRCPGGCAKCTGSSSTETSPCTYPMESMTGCMLRTTSGCIICRITTKLSK,RYHSVSVYRPECLPVGCPPQKAYSGWGCDQEEEILLCLCCHPAPDRFTPGNARYTFSLLPGLGPDSPSGPVPGEPHHPAVLSLHGQRACPCQHHPSGGPVAAYGPEPRTAAPPGQAGRLGEPLHCPGLCRVCPTVLSRARPSRQALDNDEAVYKEYDIQCWPQPSEGPCPGLACVQKVACSEWENIHSLAGLDRTCLPFLPKGQRGGESFGIHWLAGAHFRLWRLSMGDEGLAEPKKQFSSSLFHRKKANPGYLLFGFKPLYHHPCRLRKRRSNKIQLPRSARNDRHHVAQLPQSGGGSALGVAQSAELAEVQVRRPPHVHNIQWNRRAACGRPAEGVLYAELHKRSSQ