McDonnell Genome Institute

Washington University

CircRNA

chr13|32732100|32770560|+|PDS5B|ENST00000315596.14

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9965

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

LDLQHQR

Amino Acids from 5' Exons

SLASCFTSQIKRTPPSSQICHSLYPCDIFRDPVCTDI,ALLPVLHHKSKKGPPRQAKYAIHCIHAIFSSKETQFAQIFE,PCFLFYITNLKKDPPVKPNMPFIVSMRYFLVKRPSLHRYL

Amino Acids from 3' Exons

SELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEEEEERQSGNTEQKSKSKQHRVSRRAQQ,LNWRSLEAGKKRPSQNRRRNVWMTLSWYRNRNLKAVSEVGKEAIRLQNLMNSSGLRKRGSKKIYKMKMNRIVRQKRVKEADHQNLLVEVHQKKSQQKLLKKEAKKNLDLQHQRRRKKKKDKVEIRNRSPKANSTECQGEHSR,IGEARQEKNARHRTGGEIRYGLDVGTGTETRQSAKSEKRPYGFRITAVAGKEAQRRYIRKRTESAKKGKRPTTKTSWWRYTKRRANNENFKRKQKKIWTSSTRGGGRRRKTKWKYGTEVQKQTAPSVKESTAE