McDonnell Genome Institute

Washington University

CircRNA

chr13|31138406|31141259|-|HSPH1|ENST00000626866.2

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9063

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

DLLNMYIETEVSTSIK

Amino Acids from 5' Exons

DEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVVRAQEIKTKIK,MRNTTILMSLKKKWRSLLMKWNGIMSMLRLKRVLIRIQLYVLRKLKQKS,EIQPYVNEKSGEVCSDGMDECHECSGKESSGSSCTCSGNNKNQ

Amino Acids from 3' Exons

ANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEVSTSIKYFYFEICLVSWPYLYFINGHNSFSSQVLYSFRDRMKTKLTNFAVFFLTKKSFCLIHDWLSSCEKIGWQIITEHSTVGISRHTKYFYNTLYFFSSLKFNNMNNDLVFPYGGNIVFRSLFNNKLSIYLSLIKCGRVVLLYIGQYSEYGPFVYKKTKLHLSSSLIFFFFFHISLCNRLQCKNQTSAVFRKWKCLFGLEEFDKVVGTVLTLKFVLYHFFTPESTYLEFSLSLEDWNPFLFPDRVRCKINWKKKGMMLKMQLRNMCMSSETSCVDHMKNLYVS,QMKKKLTSLQKLKSPKRWMLSCLLKPTWSGSGKTFLTCILRQRVLQLNIFILKYVFLGPDIYISSRMAIILSHPKFYIVLGIGRQNRILQFNFFQKNLSAYNMIGVLVKKLDGNKSQSTVQLEFHGTLNISIRIHCIFLVVNSRIICEIIEIWFFHTEVGTSYLGVYLTINCSPFIYLFKNVAEWCDCYTLASINLNMDNHLYTRKQNYIAVAFFFFFFSIKYEVCVIGYNVKKIKLQPEYLENGNVCLVCRKSLTRYKLELCHNLFCIIFFKPQSLHINLAVNKTGINLSCFLTGDDNARIGKRKECKCSGICVVQRQAVWTIKIYMA,KKKSPASRSKAQNKGGECAAYSQLGLAVRERPSHVYDRGKYFNIFLFNMFSFLALISIFLVDKWPFFLIPSFIFGDEDKTNEFCSLIFFNKKIFLLDITLAEFLKNWMAINHNRAQYSWNFTAHIFLLEYIVFFSEILEYVKLRFGFSILRWEHRIEFIQTVVHLFIFDLKMWQSGVTVIHWPVLIIWITICIQENKITFKQLDFFFFFLALNMKSVSVTMLKKSNFSLSIKMEMSVWFVGRVQGISWNCVNTKICFVSFFLNPRVYIFRILELTRRLELTFPVSQGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQ