McDonnell Genome Institute

Washington University

CircRNA

chr13|29517572|29532982|-|SLC7A1|ENST00000380752.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9539

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

6

Peptide

ISGLIVNISTSLIGTSSVAR

Amino Acids from 5' Exons

VPARAAPGIPDGQYFRRVRSSRPKIGKHQFPAGLFTRGRDVLFENHTLTQKHGAFQNLWANCEHFNQPH,YQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIVNISTSLI,TSQSSLTWYTRWPVLPTSIQQTKMNWQAPMIPSWAFYQRQRCSLKPYSHPKTWSLPKSLGLTFQPAS

Amino Acids from 3' Exons

VLQARGPGAPPSTSADPSGSSHGHTLTPPACWLKTPTYSQSFSSQ,YFKRSEGLERHLRRADRQTHRGVLTDTHDSERPRRAGKPRHIRSDHNSHLD,TSSVARAWSATFDELIGRPIGEFSRTHMTLNAPGVLAENPDIFAVIIILILT