McDonnell Genome Institute

Washington University

CircRNA

chr13|27075190|27116596|-|USP12|ENST00000282344.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

5

Peptide

MYDLVAVVVHCGRAPMLR

Amino Acids from 5' Exons

DESKTAHDSSSTPEEIIYGSTSSIYKTLLPGSFSFRTSSVHFRCHQSRQNVRPCCCCGSLWK,MKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCG,KLKNCPFLYTRDLNIWINFIDIQNSLTGFFLNFVCLTLQVMPPIQTECTTLLLLWFTVE

Amino Acids from 3' Exons

GANASALEKEIGPEQFPVNEHYFGLVN,APMLRHRKRLVQNSFRSMSTILDS,RQCFGIRERDWSRTVSGQALFWISQ