McDonnell Genome Institute

Washington University

CircRNA

chr13|25251648|25274187|-|MTMR6|ENST00000381801.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9324

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

DLESVEQVK

Amino Acids from 5' Exons

VLEEHVPSISNTASAVCIYNYEYEAKTIRERYRPRI,FWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLES,FGGTCTINLIEHCILGSLYLILIMSKINNRKILKTN

Amino Acids from 3' Exons

VEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETW,SNKNYLTDSVPATSHQEHCILRLHIYYLSTLIKKKP,RTSKITPIQYQQQVINRNTVSYGYTSIIYRLSSKRNL