McDonnell Genome Institute

Washington University

CircRNA

chr13|25251648|25266286|-|MTMR6|ENST00000381801.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9845

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

ISMHFLIIPNK

Amino Acids from 5' Exons

VLEEHVPSISNTASAVCIYNYEYEAKTIRERYRPRI,FWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLES,FGGTCTINLIEHCILGSLYLILIMSKINNRKILKTN

Amino Acids from 3' Exons

QNMKISMHFLIIPNKMIQNDYKAGSSLISLRNIRGWECQTHTGSCLMPTGTT,KIRSLCIFLSQTKFRTTTRLAAHSRGIEDGSAKLTLAVVCQPGLQ,KYEDLYAFSYNPKQNDSERLQGWQLIDLAEEYKRMGVPNSHWQLSDANRDYK