McDonnell Genome Institute

Washington University

CircRNA

chr13|24249476|24284271|+|SPATA13|ENST00000382095.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

SSSQDEERTEAQR

Amino Acids from 5' Exons

VVPDGPWRRSSSQDEERTEAQRTPKRRWGSGRRPRPRPFSDYGQLASRSLSIPEDSVAADPQKEDRVDEDPQASMTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQ,SSLMAPGGEAHHRMRKGQRHREPPRGDGALGDGQGLGHSLTTASWPAAVCLFLKTRLLQTPRRKTVWTRTPRQALLPALKTRMLQWAAPKEPGEGAPFPVGSACMGPTRRRNWTIFP,RPWPLEAKLITGGKDRGTENPQEEMGLWETAKASAILLRPAGQPQFVYSRLGCCRPPEGRPCGRGPPGKHDFCQPRPECSSGLPQRSPEKAPHFRDRWGQLVWDQPDGGTGQSSDP

Amino Acids from 3' Exons

FLQMEVLSPLPWMTTVVRRTSAMKTSARPALGTCSPAGSSWPSM,FFRWRYALCLSGQRGGLQLRPLPGQPSVPAARRGAAGHQ,SSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGGEQLAINE