McDonnell Genome Institute

Washington University

CircRNA

chr13|24222818|24224582|+|RP11-307N16.6|ENST00000382141.4

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

TLSSSSTDSQK

Amino Acids from 5' Exons

PVATQEPDVQGRCECQDGIPGDEGLELRSADSAVPVAMTQAAVRPWAPCLENMTTAPNGLGPGPAAPCAGSDLKDAKMVTSLACGNGVCGCSPGGDTDTQEAKLSPAKLVRLFSTSRKRTGAHPERPHSMVLVGNSSTWNTLASFRKMGSFKKLKSSVLKGIQSREGSNACSKGEASEHGLGKSIPNGAVPGAQASRGSPLAPGPACGALRPAEWGTLDGSDLEDTDDAFQRSTHRSRSLRRAYGLGRICLLDAPQNHATPTIATGQVPAVCEILVRDPENNSMGYRRSKSTDNLAFLKKSSFKRKSTSNLADLRTAHDARVPQRTLSSSSTDSQKLGSGRTKRWRSPIRAKDFDRVFKLVSNVTEAAWRRESPRSGAPSPGEASLRLQAHSRLHDDYSRRVSRSTEQDSRRGGAVMHGTTATCTVAPGFGSATSKGPHLDADTAVFPLETKSSWAVESDSSCTCSSLPSPIVQDVLSKDSCDPNAGSQLTFDPEQPPTPLRPTTPKPQSPQSPQSPGAGSASCHSNHSALSANSEESEGRAEEPAQREPGPVSLQDPLEATHGDEGSKDLLVNIGVAAGPEEKEKEE,PWPPRSPMCKAGVSARTAFLEMKAWSCGLRTRQCPWPPRLPCGPGHPAWRTPLPQTASGQAPQPPVQARTKTPRWPPLRVEMESVAAALVATRTPRKPNSAQPSLCASFPPVGRGRVPTPSGPTPWSWWGTPPHGTPSPPSGKWDPLRNSPQSKEFRAERGQMPVQRERLRSMAWESPSQMALSQEPRQAGAPPHRDQHVVPSGQQSGAHWMAPTSRTRTMPSSGAHTAPAASAEPTAWAASACWMRPRTMRHPRPLARCPPCVRFSGTLKTTAWATGGARARTILPFRRAPLSGSPPPILQTSGRPMTHGYHRGPAVPPLTPKSLGQEGPNAGGARGPRTLTESSNLAMLRLPGGGRVLGVGPHPLERPADFRHTAGCMTTTPAASPGALSRTAGGAGRSCMGPLQPAPWPPVSAQPPLRGPTTLTLPYFLLKPKVPGRWKATVPALAALCQARLSRMCAKTPVTQTLAASHLTLSSLPPLGPPHPSPRALRAPRAPGQEVPAVTAITVPCPRIQRKVKEGQKSLLRESQGLCPCRIPWKPHMVMRAARTFWTLVWQPAQKKRRRR,RGHPGARCARQVVPGRHSWRRPGAAVCGLGSARGHDPGCRAALGTLPGEHDHCPKRPRARPRSPLCRLGPERRQDGDLPCVWKWSLWLQPWWRHGHPGSQTQPSQACAPLFHQSEEDGCPPRAAPLHGPGGELLHMEHPRLLPENGILETEVLSPERNSEPRGVKCLFKGRGFGAWPGKVHPKWRCPRSPGKQGLPLSTGTSMWCPQASRVGHIGWLRPRGHGRCLPAEHTPLPQPPQSLRPGPHLPAGCAPEPCDTHDSHWPGARRVDSREGPKQQHGLQEEQEHGQSCLSEEELLAEVHLQSCRPQDGPRTGTTEDPEQFLHLPKAWVRKDQTLEEPDKGQGLQSLQTCEQCDGCLEEGESEWGPIPWRGQPETSGTQPAARLLPPRLQEHAGQQAGRGGHAWDHCNLHRGPRFRLSHLGAPPRRHCRISSNQKFLGGGKRQFLHLQLFAKPDCPGCVEQRLLPKRWQPVDIPAASHPSKAHHTQAPEPSEPPEPRGRKCQLSQQSQCPVREFRGKRKGRRACSERARACVLAGSPGSHTWGQQGPSGEHWCGSRPRRKGEGG

Amino Acids from 3' Exons

PVATQEPDVQGRCECQDGIPGDEGLELRSADSAVPVAMTQAAVRPWAPCLENMTTAPNGLGPGPAAPCAGSDLKDAKMVTSLACGNGVCGCSPGGDTDTQEAKLSPAKLVRLFSTSRKRTGAHPERPHSMVLVGNSSTWNTLASFRKMGSFKKLKSSVLKGIQSREGSNACSKGEASEHGLGKSIPNGAVPGAQASRGSPLAPGPACGALRPAEWGTLDGSDLEDTDDAFQRSTHRSRSLRRAYGLGRICLLDAPQNHATPTIATGQVPAVCEILVRDPENNSMGYRRSKSTDNLAFLKKSSFKRKSTSNLADLRTAHDARVPQRTLSSSSTDSQKLGSGRTKRWRSPIRAKDFDRVFKLVSNVTEAAWRRESPRSGAPSPGEASLRLQAHSRLHDDYSRRVSRSTEQDSRRGGAVMHGTTATCTVAPGFGSATSKGPHLDADTAVFPLETKSSWAVESDSSCTCSSLPSPIVQDVLSKDSCDPNAGSQLTFDPEQPPTPLRPTTPKPQSPQSPQSPGAGSASCHSNHSALSANSEESEGRAEEPAQREPGPVSLQDPLEATHGDEGSKDLLVNIGVAAGPEEKEKEE,PWPPRSPMCKAGVSARTAFLEMKAWSCGLRTRQCPWPPRLPCGPGHPAWRTPLPQTASGQAPQPPVQARTKTPRWPPLRVEMESVAAALVATRTPRKPNSAQPSLCASFPPVGRGRVPTPSGPTPWSWWGTPPHGTPSPPSGKWDPLRNSPQSKEFRAERGQMPVQRERLRSMAWESPSQMALSQEPRQAGAPPHRDQHVVPSGQQSGAHWMAPTSRTRTMPSSGAHTAPAASAEPTAWAASACWMRPRTMRHPRPLARCPPCVRFSGTLKTTAWATGGARARTILPFRRAPLSGSPPPILQTSGRPMTHGYHRGPAVPPLTPKSLGQEGPNAGGARGPRTLTESSNLAMLRLPGGGRVLGVGPHPLERPADFRHTAGCMTTTPAASPGALSRTAGGAGRSCMGPLQPAPWPPVSAQPPLRGPTTLTLPYFLLKPKVPGRWKATVPALAALCQARLSRMCAKTPVTQTLAASHLTLSSLPPLGPPHPSPRALRAPRAPGQEVPAVTAITVPCPRIQRKVKEGQKSLLRESQGLCPCRIPWKPHMVMRAARTFWTLVWQPAQKKRRRR,RGHPGARCARQVVPGRHSWRRPGAAVCGLGSARGHDPGCRAALGTLPGEHDHCPKRPRARPRSPLCRLGPERRQDGDLPCVWKWSLWLQPWWRHGHPGSQTQPSQACAPLFHQSEEDGCPPRAAPLHGPGGELLHMEHPRLLPENGILETEVLSPERNSEPRGVKCLFKGRGFGAWPGKVHPKWRCPRSPGKQGLPLSTGTSMWCPQASRVGHIGWLRPRGHGRCLPAEHTPLPQPPQSLRPGPHLPAGCAPEPCDTHDSHWPGARRVDSREGPKQQHGLQEEQEHGQSCLSEEELLAEVHLQSCRPQDGPRTGTTEDPEQFLHLPKAWVRKDQTLEEPDKGQGLQSLQTCEQCDGCLEEGESEWGPIPWRGQPETSGTQPAARLLPPRLQEHAGQQAGRGGHAWDHCNLHRGPRFRLSHLGAPPRRHCRISSNQKFLGGGKRQFLHLQLFAKPDCPGCVEQRLLPKRWQPVDIPAASHPSKAHHTQAPEPSEPPEPRGRKCQLSQQSQCPVREFRGKRKGRRACSERARACVLAGSPGSHTWGQQGPSGEHWCGSRPRRKGEGG